Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G37060.1
Common NameNFYB8, NF-YB8, T2N18.18
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 173aa    MW: 18998.3 Da    PI: 6.9337
Description nuclear factor Y, subunit B8
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G37060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 
                  vreqdrflPian+srimk+ lPan+ki+kdake+vqecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy+eplkvyl++yre+eg++k
                  69*********************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.4E-273498IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.7E-216280No hitNo description
PROSITE patternPS0068506581IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.7E-218199No hitNo description
PRINTSPR006154.7E-21100118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0025195anatomypollen tube cell
PO:0001017developmental stageM germinated pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4728119192Transcription factor HapC (Eurofung)
4g92_B8e-4728119192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.283910.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT2G37060-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G54830, AT1G56170
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G37060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0704770.0AY070477.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds.
GenBankAY0916730.0AY091673.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850277.21e-129nuclear transcription factor Y subunit B-8
RefseqNP_973617.11e-129nuclear transcription factor Y subunit B-8
RefseqNP_001031500.11e-129nuclear transcription factor Y subunit B-8
SwissprotQ8VYK41e-130NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLD7LJN91e-121D7LJN9_ARALL; Putative uncharacterized protein
STRINGAT2G37060.11e-128(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
  4. Kwong RW, et al.
    LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
    Plant Cell, 2003. 15(1): p. 5-18
  5. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
  7. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
  8. Gutierrez L, et al.
    Identification of new gene expression regulators specifically expressed during plant seed maturation.
    J. Exp. Bot., 2006. 57(9): p. 1919-32
  9. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
  10. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
  11. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
  12. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45